missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NHE3/SLC9A3 Antibody, Novus Biologicals™
Description
NHE3/SLC9A3 Polyclonal specifically detects NHE3/SLC9A3 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, SDS-Page.
Specifications
Specifications
| Antigen | NHE3/SLC9A3 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot Reported in scientific literature (PMID: 32738496). , Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID: 32502894)., Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen Reported in scientific literature (PMID 26677983), SDS-Page Reported in scientific literature (PMID: 32738496). |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | isoform 3, MGC126718, NHE3MGC126720, solute carrier family 9 (sodium/hydrogen exchanger), member 3, Solute carrier family 9 member 3 |
| Gene Symbols | SLC9A3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?