missing translation for 'onlineSavingsMsg'
Learn More

NHE3/SLC9A3 Antibody, Novus Biologicals™

Product Code. 18413891
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18413891 25 μL 25µL
18781644 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18413891 Supplier Novus Biologicals (Bio-Techne) Supplier No. NBP18257425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 13 publications

NHE3/SLC9A3 Polyclonal specifically detects NHE3/SLC9A3 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NHE3/SLC9A3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot Reported in scientific literature (PMID: 32738496). , Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID: 32502894)., Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen Reported in scientific literature (PMID 26677983), SDS-Page Reported in scientific literature (PMID: 32738496).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias isoform 3, MGC126718, NHE3MGC126720, solute carrier family 9 (sodium/hydrogen exchanger), member 3, Solute carrier family 9 member 3
Gene Symbols SLC9A3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6550
Test Specificity Specificity of human NHE3/SLC9A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.