NHE1/SLC9A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62408

Product Code. 18505193

Description

NHE1/SLC9A1 Polyclonal antibody specifically detects NHE1/SLC9A1 in Human samples. It is validated for Western Blot

Specifications

• Antigen: NHE1/SLC9A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 0.5 mg/mL
• Dilution: Western Blot 1.0 μg/mL
• Gene Alias: APNH1, APNHFLJ42224, Na(+)/H(+) antiporter, amiloride-sensitive, Na(+)/H(+) exchanger 1, Na+/H+, amiloride sensitive), Na-Li countertransporter, NHE-1, NHE1Na+/H+ antiporter, amiloride-sensitive, sodium/hydrogen exchanger 1, solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, solute carrier family 9 (sodium/hydrogen exchanger), member 1, solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Solute carrier family 9 member 1
• Immunogen: Synthetic peptides corresponding to SLC9A1(solute carrier family 9 (sodium/hydrogen exchanger), member 1) The peptide sequence was selected form the middle region of SLC9A1. Peptide sequence RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6548
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG