NHA2/SLC9B2/NHEDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59579

Product Code. 18281104

Description

NHA2/SLC9B2/NHEDC2 Polyclonal specifically detects NHA2/SLC9B2/NHEDC2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NHA2/SLC9B2/NHEDC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 133308
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86UD5
• Gene Symbols: SLC9B2
• Immunogen: Synthetic peptides corresponding to NHEDC2(Na+/H+ exchanger domain containing 2) The peptide sequence was selected from the C terminal of NHEDC2. Peptide sequence IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Mouse: 100%; Sumatran orangutan: 100%; Human: 100%; Bovine: 92%; Canine: 85%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG