NGL-1/LRRC4C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP2-58242-25ul

Artikelnummer. 18625407

Beschreibung

NGL-1/LRRC4C Polyclonal specifically detects NGL-1/LRRC4C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

• Antigen: NGL-1/LRRC4°C
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: KIAA1580NGL-1NGL1Netrin-G1 ligand, leucine rich repeat containing 4°C, leucine-rich repeat-containing protein 4°C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57689
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LRRC4°C
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only