missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFIX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38606-20ul
This item is not returnable.
View return policy
Description
NFIX Polyclonal antibody specifically detects NFIX in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| NFIX | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| CTF, NF1ACCAAT-box-binding transcription factor, NF1-X, NF-I/X, NFI-X, nuclear factor 1 X-type, Nuclear factor 1/X, Nuclear factor I/X, nuclear factor I/X (CCAAT-binding transcription factor), TGGCA-binding protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2).,, Sequence:, AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT | |
| 20 μL | |
| Cell Cycle and Replication | |
| 4784 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction