missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFIC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | NFIC |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639215
|
Novus Biologicals
NBP2-37935-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18119248
|
Novus Biologicals
NBP2-37935 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NFIC Polyclonal specifically detects NFIC in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NFIC | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P08651 | |
| 4782 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCAAT-binding transcription factor, CTF5, CTFCCAAT-box-binding transcription factor, MGC20153, NF1-C, NFI, NF-I, NF-I/C, NFI-C, nuclear factor 1 C-type, Nuclear factor 1/C, Nuclear factor I/C, nuclear factor I/C (CCAAT-binding transcription factor), TGGCA-binding protein | |
| NFIC | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title