Invitrogen™ NFIB Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579736

Product Code. 15945305

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, rat PC-12 whole cell, mouse lung tissue, mouse ovary tissue, mouse HEPA1-6 whole cell. IHC: human mammary cancer tissue, mouse lung tissue, rat cardiac muscle tissue.

NF-1, also designated CTF, consists of a family of CCAAT box binding proteins that stimulate DNA replication and activate transcription. Analysis of human NF-1 messenger RNA has revealed two forms of the NF-1 protein arising from an alternate splicing of a single NF-1 gene. NF-1 binds its consensus DNA element as a homodimer via an amino-terminal DNA binding domain, and activates transcription through a putatively novel, proline-rich, carboxy terminal transactivation domain. The NF-1 protein has been shown to recognize and bind the adenovirus type 2 promoter and activate transcription of herpes simplex virus thymidine kinase genes. The NF-1 consensus element has been found in the upstream promoter region of myriad eukaryotic genes, including that of Ha-Ras, alpha-globin, HSP 70, GRP 78, Histone H1, myelin basic protein and in the Xenopus laevis vitellogenin gene promoter.

Specifications

• Antigen: NFIB
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: NFIB
• Gene Alias: 6720429L07Rik; CCAAT-box-binding transcription factor; CTF; E030026I10Rik; HMGIC/NFIB; NF1-B; NF-I/B; Nfib; NFI-B; NFIB2; NFIB3; NFI-RED; nuclear factor 1 B-type; nuclear factor 1/B; nuclear factor I B; nuclear factor I/B; olfactory epithelium nuclear factor I-B; TGGCA-binding protein
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 18028, 29227, 4781
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O00712, P97863
• Gene Symbols: NFIB
• Immunogen: A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG