missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18360198

NFATC3/NFAT4 Antibody (3A12), Novus Biologicals™

Product Code. 18360198 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18360198 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18360198 Supplier Novus Biologicals Supplier No. H00004775M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

NFATC3/NFAT4 Monoclonal antibody specifically detects NFATC3/NFAT4 in Human samples. It is validated for ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NFATC3/NFAT4
Applications ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3A12
Conjugate Unconjugated
Dilution ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_775188
Gene Alias NF-AT4, NFAT4nuclear factor of activated T-cells, cytoplasmic 3, NFATc3, NF-ATc3, NFATx, nuclear factor of activated T-cells c3 isoform IE-Xa, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3, T cell transcription factor NFAT4, T-cell transcription factor NFAT4
Host Species Mouse
Immunogen NFATC3 (NP_775188, 70 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 4775
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.