missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NF-L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | NF-L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18271542
|
Novus Biologicals
NBP2-58699 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670409
|
Novus Biologicals
NBP2-58699-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NF-L Polyclonal specifically detects NF-L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NF-L | |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cellular Markers, Cytoskeleton Markers, Neurodegeneration, Neurofilaments, Neuronal Cell Markers, Neuroscience | |
| 68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa | |
| NEFL | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4747 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title