missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neurotrimin/HNT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Neurotrimin/HNT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Neurotrimin/HNT Polyclonal specifically detects Neurotrimin/HNT in Human samples. It is validated for Western Blot.Specifications
| Neurotrimin/HNT | |
| Polyclonal | |
| Rabbit | |
| NP_001137530 | |
| 50863 | |
| The immunogen for this antibody is HNT - N-terminal region. Peptide sequence LSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hNT, IgLON family member 2, IGLON2HNTNT, MGC60329, neurotrimin, NTRI | |
| NTM | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title