Neuropilin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-85763-25ul

Product Code. 18403441

Description

Neuropilin-1 Polyclonal specifically detects Neuropilin-1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Neuropilin-1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: BDCA4, CD304, CD304 antigen, DKFZp686A03134, DKFZp781F1414, neuropilin 1, neuropilin-1, NP1, NRP, transmembrane receptor, Vascular endothelial cell growth factor 165 receptor, VEGF165R
• Host Species: Rabbit
• Molecular Weight of Antigen: 103 kDa
• Quantity: 25 μL
• Research Discipline: Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, Virology Bacteria and Parasites
• Gene ID (Entrez): 8829
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NRP1
• Immunogen: Neuropilin-1 Antibody was developed against a Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only