missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEURL2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94337-0.1ml
This item is not returnable.
View return policy
Description
NEURL2 Polyclonal antibody specifically detects NEURL2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| NEURL2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C20orf163, chromosome 20 open reading frame 163, dJ337O18.6, FLJ30259, MGC125934, MGC125935, neuralized homolog 2 (Drosophila), neuralized-like 2, neuralized-like 2 (Drosophila), neuralized-like protein 2, OZZ, Ozz-E3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 181-285 of human NEURL2 (NP_542787.1). LPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKDFCKYE | |
| 0.1 mL | |
| Cell Biology | |
| 140825 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction