missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neurexophilin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Neurexophilin-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Neurexophilin-3 Polyclonal specifically detects Neurexophilin-3 in Human samples. It is validated for Western Blot.Specifications
| Neurexophilin-3 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| KIAA1159, neurexophilin 3, NPH3neurexophilin-3 | |
| NXPH3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Z2N5 | |
| 11248 | |
| Synthetic peptides corresponding to NXPH3 (neurexophilin 3) The peptide sequence was selected from the middle region of NXPH3. Peptide sequence NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title