Neudesin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18429810	Novus Biologicals NBP1-84462-25ul	25 μL
18218187	Novus Biologicals NBP1-84462	0.1 mL

Description

Neudesin Polyclonal specifically detects Neudesin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Neudesin
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 29937
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Cell immortalization-related protein 2, CIR2cell growth-inhibiting protein 47, NEUDESIN, neuron derived neurotrophic factor, Neuron-derived neurotrophic factor, SCIRP10, SCIRP10-related protein, Secreted protein of unknown function, Spinal cord injury related protein 10, SPUF protein, SPUFneudesin
• Gene Symbols: NENF
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only