missing translation for 'onlineSavingsMsg'
Learn More

NEU2 Antibody (2E5), Novus Biologicals™

Product Code. 18323878 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18323878 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18323878 Supplier Novus Biologicals Supplier No. H00004759M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

NEU2 Monoclonal antibody specifically detects NEU2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen NEU2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2E5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005374
Gene Alias Cytosolic sialidase, EC 3.2.1.18, N-acetyl-alpha-neuraminidase 2, neuraminidase 2, SIAL2MGC129579, sialidase 2 (cytosolic sialidase), sialidase-2
Host Species Mouse
Immunogen NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4759
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.