missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neprilysin-2/MMEL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Neprilysin-2/MMEL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Neprilysin-2/MMEL1 Polyclonal specifically detects Neprilysin-2/MMEL1 in Human samples. It is validated for Western Blot.Specifications
| Neprilysin-2/MMEL1 | |
| Polyclonal | |
| Rabbit | |
| EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase | |
| MMEL1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 79258 | |
| Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title