NELL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58635

Product Code. 18291463

Description

NELL2 Polyclonal specifically detects NELL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NELL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: nel (chicken)-like 2, NEL-like 2 (chicken), NEL-like protein 2, Nel-related protein 2, NRP2neural epidermal growth factor-like 2, protein kinase C-binding protein NELL2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NELL2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTV
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 4753
• Target Species: Human
• Isotype: IgG

For Research Use Only