NELL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-82527-25ul

Product Code. 18494611

Description

NELL2 Polyclonal specifically detects NELL2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NELL2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID:34233189)., Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: nel (chicken)-like 2, NEL-like 2 (chicken), NEL-like protein 2, Nel-related protein 2, NRP2neural epidermal growth factor-like 2, protein kinase C-binding protein NELL2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human NELL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NELL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALR
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 4753
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only