missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | NEK7 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18403811
|
Novus Biologicals
NBP1-86444 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18412141
|
Novus Biologicals
NBP1-86444-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NEK7 Polyclonal antibody specifically detects NEK7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| NEK7 | |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol | |
| 140609 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title