missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEK5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10180-100UL
This item is not returnable.
View return policy
Description
NEK5 Polyclonal specifically detects NEK5 in Mouse samples. It is validated for Western Blot.
Specifications
| NEK5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| never in mitosis A-related kinase 5, NIMA (never in mitosis gene a)-related kinase 5, nimA-related protein kinase 5, serine/threonine-protein kinase Nek5 | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse NEK5 (NP_808566.2). Peptide sequence SVEPHPNEGEKLQSHWEETKFQELQYRKNKMKDQEYWKQLEEIRQQYHND | |
| 100 μg | |
| Protein Kinase | |
| 341676 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction