NEK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13650-25ul

Product Code. 18404922

Description

NEK3 Polyclonal specifically detects NEK3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NEK3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 2.7.11, EC 2.7.11.1, glycogen synthase A kinase, HSPK 36, HSPK36, hydroxyalkyl-protein kinase, MGC29949, Never in mitosis A-related kinase 3, NIMA (never in mitosis gene a)-related kinase 3, NimA-related protein kinase 3, phosphorylase B kinase kinase, serine/threonine-protein kinase Nek3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NEK3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
• Quantity: 25ul
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 4752
• Target Species: Human
• Isotype: IgG

For Research Use Only