missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEDD9/CASL/HEF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17640-100UL
This item is not returnable.
View return policy
Description
NEDD9/CASL/HEF1 Polyclonal antibody specifically detects NEDD9/CASL/HEF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| NEDD9/CASL/HEF1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Cas scaffolding protein family member 2, CAS2, CasL, CAS-LCASS2cas-like docking, CASLdJ49G10.2, CRK-associated substrate-related protein, dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)), dJ761I2.1, dJ761I2.1 (enhancer of filamentation (HEF1)), enhancer of filamentation 1, hEF1, HEF1Crk-associated substrate related, NEDD-9, Neural precursor cell expressed developmentally down-regulated protein 9, neural precursor cell expressed, developmentally down-regulated 9, p105, Renal carcinoma antigen NY-REN-12 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4739 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction