missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NEDD9/CASL/HEF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

NEDD9/CASL/HEF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18370495 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18370495 25 μg 25µL
18372095 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18370495 Supplier Novus Biologicals Supplier No. NBP31764025UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NEDD9/CASL/HEF1 Polyclonal antibody specifically detects NEDD9/CASL/HEF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NEDD9/CASL/HEF1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Cas scaffolding protein family member 2, CAS2, CasL, CAS-LCASS2cas-like docking, CASLdJ49G10.2, CRK-associated substrate-related protein, dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)), dJ761I2.1, dJ761I2.1 (enhancer of filamentation (HEF1)), enhancer of filamentation 1, hEF1, HEF1Crk-associated substrate related, NEDD-9, Neural precursor cell expressed developmentally down-regulated protein 9, neural precursor cell expressed, developmentally down-regulated 9, p105, Renal carcinoma antigen NY-REN-12
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4739
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.