missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEDD9/CASL/HEF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | NEDD9/CASL/HEF1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18200764
|
Novus Biologicals
NBP2-55071 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698766
|
Novus Biologicals
NBP2-55071-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NEDD9/CASL/HEF1 Polyclonal specifically detects NEDD9/CASL/HEF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| NEDD9/CASL/HEF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cas scaffolding protein family member 2, CAS2, CasL, CAS-LCASS2cas-like docking, CASLdJ49G10.2, CRK-associated substrate-related protein, dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)), dJ761I2.1, dJ761I2.1 (enhancer of filamentation (HEF1)), enhancer of filamentation 1, hEF1, HEF1Crk-associated substrate related, NEDD-9, Neural precursor cell expressed developmentally down-regulated protein 9, neural precursor cell expressed, developmentally down-regulated 9, p105, Renal carcinoma antigen NY-REN-12 | |
| NEDD9 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4739 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title