missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
NEDD8 Activating Enzyme (APPBP1/UBA3) Polyclonal specifically detects NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | NEDD8 Activating Enzyme (APPBP1/UBA3) |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_001018169.1). Peptide sequence KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?