missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18387205 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387205 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387205 Supplier Novus Biologicals Supplier No. NBP309991100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Rabbit Polyclonal Antibody

NEDD8 Activating Enzyme (APPBP1/UBA3) Polyclonal specifically detects NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen NEDD8 Activating Enzyme (APPBP1/UBA3)
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_001018169.1). Peptide sequence KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 8883
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.