missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NECAB1 Antibody (CL0580), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-52944-25ul
This item is not returnable.
View return policy
Description
NECAB1 Monoclonal antibody specifically detects NECAB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| NECAB1 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 64168 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL0580 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction