missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18397657

NDUFV3 Antibody, Novus Biologicals™

Product Code. 18397657 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18397657 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18397657 Supplier Novus Biologicals Supplier No. H00004731D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFV3 Polyclonal antibody specifically detects NDUFV3 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFV3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_001001503.1
Gene Alias CI-10k, CI-9KD, complex I 10kDa subunit, complex I, mitochondrial respiratory chain, 10-kD subunit, Complex I-9kD, mitochondrial NADH oxidoreductase-like protein, NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD), NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa, NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial, NADH-ubiquinone oxidoreductase 9 kD subunit, NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD, NADH-ubiquinone oxidoreductase 9 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD, Renal carcinoma antigen NY-REN-4
Host Species Rabbit
Immunogen NDUFV3 (NP_001001503.1, 1 a.a. - 108 a.a.) full-length human protein. MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4731
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.