Ndufs1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56504-25ul

Product Code. 18638847

Description

Ndufs1 Polyclonal specifically detects Ndufs1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Ndufs1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CI-75k, CI-75Kd, complex I 75kDa subunit, complex I, mitochondrial respiratory chain, 75-kD subunit, Complex I-75kD, EC 1.6.5.3, EC 1.6.99.3, MGC26839, mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase), NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial, PRO1304
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NDUFS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV
• Quantity: 25 μL
• Research Discipline: Vision
• Gene ID (Entrez): 4719
• Target Species: Human
• Form: Purified

For Research Use Only