NDUFC2 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33272-20ul

Product Code. 30232660

Description

NDUFC2 Monoclonal antibody specifically detects NDUFC2 in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: NDUFC2
• Classification: Monoclonal
• Dilution: Western Blot 1:500-1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human NDUFC2 (NP_004540.1).,, Sequence:, MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
• Quantity: 20 μL
• Research Discipline: Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 4718
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified