NDUFB8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17898-100UL

Product Code. 18378503

Description

NDUFB8 Polyclonal antibody specifically detects NDUFB8 in Human samples. It is validated for Western Blot

Specifications

• Antigen: NDUFB8
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml
• Gene Alias: CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
• Quantity: 100 μg
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 4714
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified