NDUFB4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18451702	Novus Biologicals NBP2-33626-25ul	25 μL
18154405	Novus Biologicals NBP2-33626	0.1 mL

Description

NDUFB4 Polyclonal specifically detects NDUFB4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NDUFB4
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: B15, CI-B15, complex I B15 subunit, Complex I-B15, MGC5105, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4 (15kD, B15), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, NADH-ubiquinone oxidoreductase B15 subunit
• Gene Symbols: NDUFB4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O95168
• Gene ID (Entrez): 4710
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only