missing translation for 'onlineSavingsMsg'
Learn More

NDUFB1 Antibody, Novus Biologicals™

Codice prodotto. 18391368 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
0.1 mg
Dimensione della confezione:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18391368 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18391368 Fornitore Novus Biologicals N. del fornitore H00004707D01P

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

NDUFB1 Polyclonal antibody specifically detects NDUFB1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigen NDUFB1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_004536.2
Gene Alias CI-MNLLCI-SGDH, complex I MNLL subunit, Complex I-MNLL, MNLL, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (7kD, MNLL), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1, NADH-ubiquinone oxidoreductase MNLL subunit
Host Species Rabbit
Immunogen NDUFB1 (NP_004536.2, 1 a.a. - 105 a.a.) full-length human protein. MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4707
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.