missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18412021

NDUFA8 Antibody, Novus Biologicals™

Product Code. 18412021 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18412021 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18412021 Supplier Novus Biologicals Supplier No. NBP182661

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFA8 Polyclonal antibody specifically detects NDUFA8 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFA8
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 to 1:500, Immunohistochemistry-Paraffin 1:200 to 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CI-19KD, CI-PGIV, complex I PGIV subunit, Complex I-19kD, Complex I-PGIV, MGC793, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8, NADH:ubiquinone oxidoreductase PGIV subunit, NADH-ubiquinone oxidoreductase 19 kDa subunit, PGIV
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4702
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.