missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | NDUFA7 |
|---|---|
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18266421
|
Novus Biologicals
NBP2-57928 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634427
|
Novus Biologicals
NBP2-57928-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NDUFA7 Polyclonal specifically detects NDUFA7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| NDUFA7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 4701 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| B14.5a, CI-B14.5a, complex I B14.5a subunit, Complex I-B14.5a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5kD, B14.5a), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7, NADH-ubiquinone oxidoreductase subunit B14.5a | |
| NDUFA7 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit