missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94096-0.02ml
This item is not returnable.
View return policy
Description
NDUFA3 Polyclonal antibody specifically detects NDUFA3 in Human samples. It is validated for Western Blot
Specifications
| NDUFA3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| B9, CI-B9, complex I B9 subunit, Complex I-B9, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3, NADH-ubiquinone oxidoreductase B9 subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human NDUFA3 (NP_004533.1). MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL | |
| 0.02 mL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4696 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction