missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38523-100ul
This item is not returnable.
View return policy
Description
NDUFA1 Polyclonal antibody specifically detects NDUFA1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NDUFA1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NDUFA1 (NP_004532.1).,, Sequence:, MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4694 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction