missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDST4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NDST4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NDST4 Polyclonal specifically detects NDST4 in Human samples. It is validated for Western Blot.Specifications
| NDST4 | |
| Polyclonal | |
| Rabbit | |
| Q9H3R1 | |
| 64579 | |
| Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4 | |
| NDST4 | |
| IgG | |
| 101 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title