missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15905295

Invitrogen™ NDRG2 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15905295
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15905295 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15905295 Supplier Invitrogen™ Supplier No. PA579722

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue. IHC: mouse brain tissue, rat brain tissue.

NDRG2's gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDRG2
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene NDRG2
Gene Accession No. Q8VBU2, Q9QYG0, Q9UN36
Gene Alias AI182517; antidepressant-related protein ADRG123; AU040374; cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; Kiaa1248; NDR1-related protein NDR2; Ndr2; NDRG family member 2; NDRG1-related protein; NDRG2; NDRG2var; N-myc downstream regulated 2; N-Myc downstream regulated gene 2; N-myc downstream regulator 2; N-myc downstream-regulated gene 2; N-myc downstream-regulated gene 2 protein; Protein Ndr2; protein NDRG2; Protein Syld709613; SYLD; syld709613 protein
Gene Symbols NDRG2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 171114, 29811, 57447
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.