Invitrogen™ NDRG2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579722

Product Code. 15905295

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue. IHC: mouse brain tissue, rat brain tissue.

NDRG2's gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Specifications

• Antigen: NDRG2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: NDRG2
• Gene Alias: AI182517; antidepressant-related protein ADRG123; AU040374; cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; Kiaa1248; NDR1-related protein NDR2; Ndr2; NDRG family member 2; NDRG1-related protein; NDRG2; NDRG2var; N-myc downstream regulated 2; N-Myc downstream regulated gene 2; N-myc downstream regulator 2; N-myc downstream-regulated gene 2; N-myc downstream-regulated gene 2 protein; Protein Ndr2; protein NDRG2; Protein Syld709613; SYLD; syld709613 protein
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 171114, 29811, 57447
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q8VBU2, Q9QYG0, Q9UN36
• Gene Symbols: NDRG2
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG