missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCRNA00114 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NCRNA00114 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NCRNA00114 Polyclonal specifically detects NCRNA00114 in Human samples. It is validated for Western Blot.Specifications
| NCRNA00114 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 400866 | |
| Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C21orf24, long intergenic non-protein coding RNA 114, NCRNA00114 | |
| LINC00114 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title