missing translation for 'onlineSavingsMsg'
Learn More

NCOA6 Antibody, Novus Biologicals™

Product Code. 18403341 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403341 25 μL 25µL
18276937 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18403341 Supplier Novus Biologicals Supplier No. NBP18919325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NCOA6 Polyclonal specifically detects NCOA6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NCOA6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q14686
Gene Alias Activating signal cointegrator 2, AIB3NRC RAP250, Amplified in breast cancer protein 3, ASC-2, Cancer-amplified transcriptional coactivator ASC-2, KIAA0181PPAR-interacting protein, NRCamplified in breast cancer-3 protein, nuclear receptor coactivator 6, Nuclear receptor coactivator RAP250, Nuclear receptor-activating protein, 250 kDa, peroxisome proliferator-activated receptor interacting protein, PRIPPeroxisome proliferator-activated receptor-interacting protein, RAP250Thyroid hormone receptor-binding protein, thyroid hormone receptor binding protein, TRBPASC2activating signal cointegrator-2
Gene Symbols NCOA6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, DNA Repair, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 23054
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.