missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCOA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | NCOA4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18263405
|
Novus Biologicals
NBP2-56237 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18697118
|
Novus Biologicals
NBP2-56237-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NCOA4 Polyclonal specifically detects NCOA4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NCOA4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Androgen receptor coactivator 70 kDa protein, Androgen receptor-associated protein of 70 kDa, ARA70RFGret fused, DKFZp762E1112, ELE1NCoA-4, nuclear receptor coactivator 4,70 kDa AR-activator, PTC3RET-activating gene ELE1, Ret-activating protein ELE1,70 kDa androgen receptor coactivator | |
| NCOA4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8031 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title