missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCOA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | NCOA2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18265381
|
Novus Biologicals
NBP2-55879 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623537
|
Novus Biologicals
NBP2-55879-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NCOA2 Polyclonal specifically detects NCOA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NCOA2 | |
| Polyclonal | |
| Rabbit | |
| Cancer, DNA Repair, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10499 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| BHLHE75, bHLHe75MGC138808, Class E basic helix-loop-helix protein 75, EC 2.3.1.48, GRIP1glucocorticoid receptor-interacting protein-1, KAT13C, NCoA-2SRC2, nuclear receptor coactivator 2, TIF2hTIF2, Transcriptional intermediary factor 2 | |
| NCOA2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title