missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16197152

NCAPD3, Mouse anti-Human, Clone: 1D5, Abnova™

Product Code. 16197152
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16197152 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16197152 Supplier Abnova Supplier No. H00023310M01.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Sequence: MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI

Specifications

Antigen NCAPD3
Applications ELISA, Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone 1D5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene non-SMC condensin II complex, subunit D3
Gene Accession No. BC011408.1
Gene Alias CAP-D3/FLJ42888/KIAA0056/MGC104671/hCAP-D3/hHCP-6/hcp-6
Gene Symbols NCAPD3
Host Species Mouse
Immunogen KIAA0056 (AAH11408.1, 1 a.a. ∼ 341 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23310
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.