missing translation for 'onlineSavingsMsg'
Learn More

NBEAL1 Antibody, Novus Biologicals™

Product Code. p-200042308 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18438851 25 μL 25µL
18190794 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18438851 Supplier Novus Biologicals Supplier No. NBP23355325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NBEAL1 Polyclonal specifically detects NBEAL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NBEAL1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q6ZS30
Gene Alias A530083I02Rik, ALS2CR16, ALS2CR17FLJ22838, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 16, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 17, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein, beach, FLJ26555, MGC164581, MGC168834, neurobeachin-like 1, neurobeachin-like protein 1
Gene Symbols NBEAL1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 65065
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.