missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18351419

Nav1.7 Antibody (5A11), Novus Biologicals™

Product Code. 18351419 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18351419 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18351419 Supplier Novus Biologicals Supplier No. H00006335M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Nav1.7 Monoclonal antibody specifically detects Nav1.7 in Human, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Nav1.7
Applications Western Blot, ELISA
Classification Monoclonal
Clone 5A11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002968
Gene Alias ETHA, FEB3B, NE-NA, NENAVoltage-gated sodium channel subunit alpha Nav1.7, Neuroendocrine sodium channel, Peripheral sodium channel 1, PN1hNE-Na, sodium channel protein type 9 subunit alpha, Sodium channel protein type IX subunit alpha, sodium channel, voltage-gated, type IX, alpha subunit, voltage-gated sodium channel alpha subunit Nav1.7, voltage-gated, type IX, alpha polypeptide
Host Species Mouse
Immunogen SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cellular Signaling, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6335
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.