missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nav1.6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21269-100ul
This item is not returnable.
View return policy
Description
Nav1.6 Polyclonal antibody specifically detects Nav1.6 in Human samples. It is validated for Immunofluorescence
Specifications
| Nav1.6 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT | |
| 100 μg | |
| Neurodegeneration, Neuroscience | |
| 6334 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction