missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nav1.5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
Nav1.5 Polyclonal antibody specifically detects Nav1.5 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | Nav1.5 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | cardiac sodium channel alpha subunit, cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit, CDCD2VF1, HB1sodium channel, voltage-gated, type V, alpha (long QT syndrome 3), HB2, HBBD, HH1CMD1E, ICCD, IVF, LQT3SSS1CMPD2, Nav1.5, PFHB1, Sodium channel protein cardiac muscle subunit alpha, sodium channel protein type 5 subunit alpha, sodium channel protein type V alpha subunit, Sodium channel protein type V subunit alpha, sodium channel, voltage-gated, type V, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?