missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NARG1L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | NARG1L |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NARG1L Polyclonal specifically detects NARG1L in Human samples. It is validated for Western Blot.Specifications
| NARG1L | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ22054, MGC40612, N(alpha)-acetyltransferase 16, NatA auxiliary subunit, N-alpha-acetyltransferase 16, NatA auxiliary subunit, NARG1L, NARG1-like protein, NAT2, NMDA receptor regulated 1-like, NMDA receptor-regulated 1-like protein, PRO2435 | |
| The immunogen is a synthetic peptide directed towards the middle region of human NARG1L (NP_078837). Peptide sequence RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 79612 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title